PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0161s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 383aa    MW: 42751.2 Da    PI: 5.2774
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0161s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94e-171460147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                            rg+WT++Ed + +  v+++G+g+W++++r+ g+ R++k+c++rw++ 
  SapurV1A.0161s0110.1.p 14 RGPWTADEDSKMLAHVAKHGTGNWTAVPRKAGLERCGKSCRLRWNNC 60
                            89*******************************************96 PP

2Myb_DNA-binding377.7e-1268110246
                             SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             +++T++E+e ++++++  G++ W+ Ia+ ++ gRt++++k  w++
  SapurV1A.0161s0110.1.p  68 DNFTPQEEEMIIRLHAAIGSR-WSIIAQQLP-GRTDNDVKKCWNS 110
                             68*******************.*********.********98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-22764IPR009057Homeodomain-like
PROSITE profilePS5129421.468965IPR017930Myb domain
SuperFamilySSF466891.8E-2812108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002499.6E-151461IPR001005SANT/Myb domain
CDDcd001673.32E-101659No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2165116IPR009057Homeodomain-like
SMARTSM007177.3E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129414.93267116IPR017930Myb domain
PfamPF002491.2E-1069110IPR001005SANT/Myb domain
CDDcd001671.40E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MVRPPWCDKL NGKRGPWTAD EDSKMLAHVA KHGTGNWTAV PRKAGLERCG KSCRLRWNNC  60
LRPDLEHDNF TPQEEEMIIR LHAAIGSRWS IIAQQLPGRT DNDVKKCWNS RLRKKLSEMG  120
IDPVTHKPLS KILADYGNIG GHVKSGSRIG SLSRDLKNVF TMKPEKYNSI LPEGISNIDG  180
HLMTTMLPPK MEPVQECFLN KFNNDSINGN HSLDLLYQLQ AIKMVTEASG TCAEYQTMLE  240
PNHNVFDEGS SSSSTCSIEA QENLPTSSSW CDFLLEDQFL PSDPQEEQEN AAELSSKDLT  300
NQAQNVIVTN HCQNPGMMKP KYDQIIAEVN VGVDLTVQSN IGFGDQVAPS SSQHSSFVET  360
IIDGENKIFL DFPNLLEELF NY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321544.10.0hypothetical protein POPTR_0015s07900g
TrEMBLB9IEI50.0B9IEI5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-65MYB family protein